Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application)
- (2)
- (970)
- (1)
- (23,544)
- (5)
- (1)
- (1)
- (67)
- (220)
- (4,417)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,464)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,719)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,221)
- (265)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,929)
- (1,408)
- (3)
- (4)
- (5)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (137)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (82)
- (12)
- (2)
- (3)
- (86)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,525)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (199)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,726)
- (6)
- (4)
- (1)
- (3)
- (1)
- (4)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (26,018)
- (238)
- (1)
- (3)
Recombinant
- (286)
- (2)
- (62,020)
- (1)
Form
- (15)
- (1)
- (2)
- (45,313)
- (5,871)
- (245)
- (168)
- (56)
- (3,364)
Species
- (2)
- (1)
- (2)
- (1)
- (21)
- (560)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,139)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,027)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,575)
- (1)
- (50)
Conjugate
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (46)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (39,219)
- (1)
- (11)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
211
–
225
of
108,477
results
Invitrogen™ Human TEX264 (aa 107-184) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TEX264 (aa 107-184) Control Fragment |
| Recombinant | Recombinant |
Invitrogen™ Human RET, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | RET |
| Molecular Weight (g/mol) | 79 kDa |
| KinaseFamily | RET Kinase Family |
| Gene Symbol | RET |
| Kinase Group | Tyrosine Kinases |
| Sequence | 658-1114 |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human RET, GST Tag |
| Accession Number | P07949 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | Cadherin family member 12; Cadherin family member 12 (CDHF12); Cadherin related family member 16 (CDHR16); cadherin-related family member 16; CDHF12; CDHR16; CG1061; CG14396; CG14396-PA; CG14396-PB; CG14396-PC; c-Ret; CUX1/RET fusion; Dmel\CG14396; Dmel_CG14396; DmHD-59; DmRet; Dret; D-ret; EC 2.7.10.1; ELKS; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment; HD-59; HSCR1; Hydroxyaryl protein kinase; hydroxyaryl-protein kinase; kinase Ret; MEN2; MEN2A; MEN2B; MTC1; Multiple endocrine neoplasia and medullary thyroid carcinoma 1; Oncogene RET; OTTHUMP00000216967; proto-oncogene c-Ret; Proto-oncogene tyrosine-protein kinase receptor Ret; PTC; rearranged during transfection; receptor tyrosine kinase; ret; RET ELE1; Ret gene for receptor tyrosin; Ret oncogene; ret proto-oncogene; ret proto-oncogene (multiple endocrine neoplasia and medullary thyroid carcinoma 1, Hirschsprung disease); Ret proto-oncogene (multiple endocrine neoplasia MEN2A MEN2B and medullary thyroid carcinoma 1 Hirschsprung disease); RET receptor tyrosine kinase; RET transforming sequence; RET51; RET9; RET-ELE1; Reto; Ret-PA; Ret-PB; Ret-PC; Soluble RET kinase fragment |
| Product Type | Protein |
| Gene ID (Entrez) | 5979 |
| Formulation | 50mM tris HCl with 2mM DTT, 150mM NaCl, 50% glycerol, 0.5mM EDTA, 0.02% Triton X-100 and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human KIT, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | 80% by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | c-Kit (CD117) |
| Molecular Weight (g/mol) | 53.3 kDa |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human KIT, His Tag |
| Accession Number | P10721 |
| Gene Alias | belly-spot; Bs; CD117; ckit; C-Kit; c-KIT gene1; c-kit protein; c-kit proto-oncogene protein; c-kit receptor; c-kit receptor tyrosine kinase; dominant spotting; Dominant white spotting; Fdc; Gsfsco1; Gsfsco5; Gsfsow3; KIT; kit oncogene; KIT proto-oncogene receptor tyrosine kinase; KIT proto-oncogene, receptor tyrosine kinase; mast cell growth factor receptor; mast/stem cell growth factor receptor; mast/stem cell growth factor receptor Kit; MGF; p145 c-kit; PBT; Piebald trait protein; protein kinase; proto-oncogene c-Kit; proto-oncogene tyrosine-protein kinase Kit; receptor tyrosine kinase c-kit; receptor tyrosine kinase type III; SCFR; SCO1; SCO5; Sl; soluble KIT variant 1; SOW3; spotted sterile male; Ssm; Steel Factor Receptor; Tr-kit; tyrosine kinase receptor; tyrosine kinase receptor c-KIT; tyrosine-protein kinase Kit; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog; v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein; W |
| Gene ID (Entrez) | 3815 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human EIF2AK2 (PKR), GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | PKR |
| Molecular Weight (g/mol) | 62.2 kDa |
| KinaseFamily | PEK Kinase Family |
| Gene Symbol | EIF2AK2 |
| Sequence | 252-551 |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human EIF2AK2 (PKR), GST Tag |
| Accession Number | P19525 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 2310047A08Rik; 4732414G15Rik; AI467567; AI747578; double stranded RNA activated protein kinase; dsRNA-activated kinase; EC 2.7.11.1; eIF-2 alpha; eIF2a Kinase; eIF-2A protein kinase 2; EIF2AK1; EIF2AK2; eukaryotic translation initiation factor 2 alpha kinase 2; eukaryotic translation initiation factor 2-alpha kinase 2; IFN- type I-induced and dsRNA-activated kinase; IFN-induced and double-stranded RNA-activated kinase; interferon-induced, double-stranded RNA-activated protein kinase; interferon-inducible elF2alpha kinase; interferon-inducible RNA-dependent protein kinase; MGC126524; OTTHUMP00000201320; P1/eIF-2A protein kinase; p68 kinase; PKR; PPP1R83; Prkr; protein kinase R; protein kinase RNA-activated; protein kinase, interferon inducible double stranded RNA dependent; Protein kinase, interferon-inducible double stranded RNA dependent; protein phosphatase 1, regulatory subunit 83; serine/threonine-protein kinase TIK; T-cell viral integration site; Tik; Tyrosine-protein kinase EIF2AK2 |
| Product Type | Protein |
| Gene ID (Entrez) | 5610 |
| Formulation | 50mM tris with 2mM DTT, 50% glycerol, 0.5mM EDTA, 150mM NaCl, 0.02% Triton X-100 and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human MYO3B (MYO3 beta), GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | MYO3B |
| Molecular Weight (g/mol) | 63.3 kDa |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human MYO3B (MYO3 beta), GST Tag |
| Accession Number | Q8WXR4 |
| Gene Alias | A430065P19Rik; MYO3B; myosin IIIB; myosin IIIB1; myosin IIIB2; myosin-IIIb; RGD1560313 |
| Protein Length | 1-362 |
| Gene ID (Entrez) | 140469 |
| Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM EGTA, 0.1 mM PMSF, 0.25 mM DTT, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human CDK2/cyclin E1, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | CDK2 |
| Molecular Weight (g/mol) | 60.2-73.4 kDa |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human CDK2/cyclin E1, GST Tag |
| Accession Number | P24941 |
| Gene Alias | A630093N05Rik; CDC28; CDC2A; cdc2-related protein kinase; CDK1; CDK2; CDKN2; Cell division protein kinase 2; cyclin dependent kinase 2; cyclin dependent kinase 2-alpha; cyclin-dependent kinase 2; EC 2.7.11.22; EC 2.7.11.23; kinase Cdc2; MPF; p33 protein kinase; p33(CDK2); p33CDK2; p34 protein kinase |
| Protein Length | 1-298 |
| Gene ID (Entrez) | 1017 |
| Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human EphA2, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 76.7 kDa |
| Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human EphA2, GST Tag |
| Recombinant | Recombinant |
Invitrogen™ Human MINK1, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 63.9 kDa |
| Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human MINK1, GST Tag |
| Recombinant | Recombinant |
Invitrogen™ Human AMPK A2/B1/G1, GST Tag, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | AMPK alpha-2/beta-1/gamma-1 |
| Molecular Weight (g/mol) | 91.4-57.8-41.7 kDa |
| KinaseFamily | CAMKL Kinase Family |
| Gene Symbol | PRKAA2, PRKAB1, PRKAG1 |
| Sequence | Full length |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human AMPK A2/B1/G1, GST Tag, His Tag |
| Accession Number | P54619, P54646, Q9Y478 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | AMPK alpha 2/beta 1/gamma 1; AMPK alpha2/beta1/gamma1 |
| Product Type | Protein |
| Gene ID (Entrez) | 5563, 5564, 5571 |
| Formulation | 50mM tris with 2mM DTT, 50% glycerol, 0.5mM EDTA, 150mM NaCl, 0.02% Triton X-100 and no preservative; pH 7.5 |
| Protein Tag | GST-tag, His-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human AMPK alpha-1/beta-2/gamma-1, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | AMPK alpha-1/beta-2/gamma-1 |
| Molecular Weight (g/mol) | 63.6-36-40 kDa |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human AMPK alpha-1/beta-2/gamma-1, His Tag |
| Protein Length | 10-end |
| Formulation | 50 mM sodium phosphate with 0.1 mM PMSF, 0.2 mM DTT, 150 mM Imidazole, 25% glycerol, 300 mM NaCl and no preservative; pH 7 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human CASK, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | CASK |
| Molecular Weight (g/mol) | 91 kDa |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human CASK, GST Tag |
| Accession Number | O14936 |
| Gene Alias | CAGH39; calcium/calmodulin dependent serine protein kinase; calcium/calmodulin-dependent serin protein kinase; Calcium/calmodulin-dependent serine protein kinase; calcium/calmodulin-dependent serine protein kinase (MAGUK family); calcium/calmodulin-dependent serine protein kinase membrane-associated guanylate kinase; CAMGUK; CASK; CMG; DXPri1; DXRib1; FGS4; G-protein-coupled receptor GPR34; hCASK; LIN2; LIN-2; MGC7449; MICPCH; mLin-2; MRXSNA; OTTHUMP00000023157; OTTHUMP00000023161; OTTHUMP00000023162; Pals3; peripheral plasma membrane protein CASK; Protein lin-2 homolog; RP23-278L4.1; TNRC8; trinucleotide repeat containing 8 |
| Protein Length | 1-570 |
| Gene ID (Entrez) | 8573 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human ROCK1, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | ROCK1 |
| Molecular Weight (g/mol) | 89.7 kDa |
| KinaseFamily | DMPK Kinase Family |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human ROCK1, GST Tag |
| Purification Method | Purified |
| Gene Alias | 1110055K06Rik; Ac2-154; Liver regeneration-related protein LRRG199; MGC131603; MGC43611; p150 RhoA-binding kinase ROK beta; p160 ROCK-1; p160ROCK; p160-ROCK; PRO0435; Renal carcinoma antigen NY-REN-35; Rho associated coiled-coil containing protein kinase 1; Rho kinase; Rho-associated coiled-coil containing protein kinase 1; Rho-associated coiled-coil forming kinase 1; Rho-associated kinase beta; rho-associated protein kinase 1; Rho-associated, coiled-coil containing protein kinase 1; rho-associated, coiled-coil-containing protein kinase 1; Rho-associated, coiled-coil-containing protein kinase I; ROCK1; ROCK-I |
| Protein Form | Recombinant, Catalytic |
| Formulation | 50mM tris with 150mM NaCl, 0.5mM EDTA, 0.02% Triton X-100, 50% glycerol, 2mM DTT and no preservative; pH 7.5 |
| Species | Human |
| Recombinant | Recombinant |
| Shipping Condition | Dry Ice |
| Gene Symbol | Rock1 |
| Sequence | 1-535 |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Protein Subtype | Serine/Threonine Kinases |
| Accession Number | Q13464 |
| Regulatory Status | RUO |
| Product Type | Protein |
| Gene ID (Entrez) | 6093 |
| Protein Tag | GST-tag |
Invitrogen™ Human EEF2K, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | EEF2K |
| Molecular Weight (g/mol) | 109.9 kDa |
| KinaseFamily | Alpha Kinase Family |
| Sequence | Full length |
| Concentration | See Label |
| Expression System | E. coli |
| For Use With (Application) | Kinase Assay |
| Name | Human EEF2K, GST Tag |
| Accession Number | O00418 |
| Regulatory Status | RUO - research use only |
| Gene Alias | C86191; Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase; calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase; calmodulin-dependent protein kinase III; EC 2.7.11.20; eEF-2 kinase; Eef2k; eEF-2 K; EF2K; elongation factor 2 kinase; elongation factor-2 kinase; euk; eukaroytic elongation factor 2 kinase; eukaryotic elongation factor 2 kinase; eukaryotic elongation factor-2 kinase; HSU93850; kinase eEF2K; SMEF2K |
| Gene ID (Entrez) | 29904 |
| Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
Invitrogen™ Human JAK2 [V617F], JH1 and JH2 Domains, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 97.9 kDa |
| Formulation | 50 mM tris with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human JAK2 [V617F], JH1 and JH2 Domains, GST Tag |
| Recombinant | Recombinant |
Invitrogen™ Sambucus Nigra (Elderberry Bark) Lectin (SNA, EBL), fluorescein (FITC)
Bright-green SNA-fluorophor conjugate
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More